PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.7G157900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family DBB
Protein Properties Length: 259aa    MW: 27207.5 Da    PI: 4.5544
Description DBB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.7G157900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box23.31.3e-07446541
            zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41
                         C+ +e   ++  C  ++  lC+ C +e+H        H++ p
  Sevir.7G157900.1.p  4 QCDACEGAAATVVCCADEAALCARCDVEIHAAnklaskHQRLP 46
                        6******99*********************6678888898877 PP

2zf-B_box28.63e-095687334
            zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeH 34
                         ++C+ ++ek++ +fC +++ l+C+dC + +H
  Sevir.7G157900.1.p 56 LPRCDVCQEKPAFIFCVEDRALFCRDCDEPIH 87
                        689**************************999 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.997147IPR000315B-box-type zinc finger
CDDcd000217.00E-7347No hitNo description
SMARTSM003362.1E-9447IPR000315B-box-type zinc finger
PfamPF006431.6E-5447IPR000315B-box-type zinc finger
PROSITE profilePS501198.5654101IPR000315B-box-type zinc finger
SMARTSM003363.0E-1454101IPR000315B-box-type zinc finger
CDDcd000214.24E-85787No hitNo description
PfamPF006435.5E-75797IPR000315B-box-type zinc finger
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MRIQCDACEG AAATVVCCAD EAALCARCDV EIHAANKLAS KHQRLPLDGE GAAGDLPRCD  60
VCQEKPAFIF CVEDRALFCR DCDEPIHVPG TLSGNHQRYL ATGIRVGFSS VCGAGAGAGA  120
EGLPPPKGSS NSKPAATAGA AKTPPVVKDA QPQEVPSSPF LPPSGWAVED LLQLSDYESS  180
DKDSPLGFKE LEWFADIDLF HGHAPAKTTT AEVPELFASP QPATNAGFYK ATGARQSKKP  240
RVQLPDDEDD FFIVPDLG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8417671e-136CT841767.1 Oryza rufipogon (W1943) cDNA clone: ORW1943C103C07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004976063.10.0PREDICTED: B-box zinc finger protein 24-like
SwissprotQ962883e-70BBX24_ARATH; B-box zinc finger protein 24
TrEMBLK3Y9J20.0K3Y9J2_SETIT; Uncharacterized protein
STRINGSi010884m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32023368
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06040.12e-68DBB family protein